Host taxon 9606
Protein NP_001289052.1
C-X-C motif chemokine 11 isoform 2 precursor
Homo sapiens
Gene CXCL11, UniProt O14625
>NP_001289052.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|C-X-C motif chemokine 11 isoform 2 precursor
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKLKERIFKNIKTYEVLEKSI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 7.09 | 7.08714291846417 | 0.0015 | 25649146 | |
Retrieved 1 of 1 entries in 163.3 ms
(Link to these results)