Host taxon 9606
Protein NP_001269314.1
casein kinase II subunit beta isoform 2
Homo sapiens
Gene CSNK2B, UniProt P67870
>NP_001269314.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|casein kinase II subunit beta isoform 2
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ -3.71 | -3.70739615909191 | 0.037 | 25649146 | |
Retrieved 1 of 2 entries in 58.1 ms
(Link to these results)