Host taxon 9606
Protein NP_001007233.1
caspase recruitment domain-containing protein 17
Homo sapiens
Gene CARD17, UniProt Q5XLA6
>NP_001007233.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|caspase recruitment domain-containing protein 17
MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 4.94 | 4.93724656861849 | 0.021 | 25649146 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)