Host taxon 9606
Protein NP_001159474.2
DNA dC->dU-editing enzyme APOBEC-3H isoform SV-182
Homo sapiens
Gene APOBEC3H, UniProt Q6NTF7
>NP_001159474.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|DNA dC->dU-editing enzyme APOBEC-3H isoform SV-182
MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 5.31 | 5.30599004306221 | 0.028 | 25649146 | |
Retrieved 1 of 4 entries in 1.2 ms
(Link to these results)