Host taxon 9606
Protein NP_001136248.2
glutathione-specific gamma-glutamylcyclotransferase 1 isoform b
Homo sapiens
Gene CHAC1, UniProt Q9BUX1
>NP_001136248.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|glutathione-specific gamma-glutamylcyclotransferase 1 isoform b
MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ -3.78 | -3.78028391701265 | 2.6e-18 | 25649146 | |
Retrieved 1 of 1 entries in 109.3 ms
(Link to these results)