Host taxon 9606
Protein NP_003856.1
homeobox expressed in ES cells 1
Homo sapiens
Gene HESX1, UniProt Q9UBX0
>NP_003856.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|homeobox expressed in ES cells 1
MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.71 | 3.71166905718401 | 0.0013 | 25649146 | |
Retrieved 1 of 1 entries in 76.8 ms
(Link to these results)