Host taxon 9606
Protein NP_066362.2
interferon-induced transmembrane protein 3
Homo sapiens
Gene IFITM3, UniProt Q01628
>NP_066362.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|interferon-induced transmembrane protein 3
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 4.01 | 4.01330682188016 | 0.0029 | 25649146 | |
Retrieved 1 of 1 entries in 2.7 ms
(Link to these results)