Host taxon 9606
Protein NP_001230468.1
interleukin-15 receptor subunit alpha isoform 3
Homo sapiens
Gene IL15RA, UniProt Q13261
>NP_001230468.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|interleukin-15 receptor subunit alpha isoform 3
MSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.42 | 3.41880225055507 | 0.0078 | 25649146 | |
Retrieved 1 of 3 entries in 29.8 ms
(Link to these results)