Host taxon 9606
Protein NP_001137389.1
lysM and putative peptidoglycan-binding domain-containing protein 2 isoform 2
Homo sapiens
Gene LYSMD2, UniProt Q8IV50
>NP_001137389.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|lysM and putative peptidoglycan-binding domain-containing protein 2 isoform 2
MEQIKRANKLFTNDCIFLKKTLNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.28 | 3.28483506359353 | 0.00012 | 25649146 | |
Retrieved 1 of 1 entries in 37 ms
(Link to these results)