Host taxon 9606
Protein NP_001254635.1
programmed cell death 1 ligand 1 isoform b precursor
Homo sapiens
Gene CD274, UniProt Q9NZQ7
>NP_001254635.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|programmed cell death 1 ligand 1 isoform b precursor
MRIFAVFIFMTYWHLLNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.75 | 3.74706729408049 | 0.015 | 25649146 | |
Retrieved 1 of 1 entries in 19.9 ms
(Link to these results)