Host taxon 9606
Protein NP_067648.1
prostate and breast cancer overexpressed gene 1 protein
Homo sapiens
Gene PBOV1, UniProt Q9GZY1
>NP_067648.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|prostate and breast cancer overexpressed gene 1 protein
MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDYSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFTLTLQLTQTLGLECCLLYLSKTIHPQII
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.55 | 3.55415597336983 | 0.014 | 25649146 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)