Host taxon 9606
Protein NP_078798.2
sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 precursor
Homo sapiens
Gene NKAIN1, UniProt Q4KMZ8
>NP_078798.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 precursor
MGKCSGRCTLVAFCCLQLVAALERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 4.82 | 4.82083522161706 | 0.017 | 25649146 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)