Host taxon 9606
Protein NP_001129057.1
solute carrier family 2, facilitated glucose transporter member 5 isoform 2
Homo sapiens
Gene SLC2A5, UniProt P22732
>NP_001129057.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|solute carrier family 2, facilitated glucose transporter member 5 isoform 2
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGEFRTSREHPHPFTTTLGPLLVFQSHHHRTGLSADWSLLTGWMSLGGPSCPEPT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ 2.87 | 2.87125376957003 | 0.019 | 25649146 | |
Retrieved 1 of 1 entries in 87.1 ms
(Link to these results)