Host taxon 9606
Protein NP_001177871.1
tumor necrosis factor ligand superfamily member 10 isoform 2
Homo sapiens
Gene TNFSF10, UniProt P50591
>NP_001177871.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|tumor necrosis factor ligand superfamily member 10 isoform 2
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKTPRMKRLWAAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.94 | 3.94218099208025 | 0.0052 | 25649146 | |
Retrieved 1 of 2 entries in 39.1 ms
(Link to these results)