Host taxon 9606
Protein NP_005092.1
ubiquitin-like protein ISG15
Homo sapiens
Gene ISG15, UniProt P05161
>NP_005092.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|ubiquitin-like protein ISG15
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●○ 3.7 | 3.7016537284542 | 0.0019 | 25649146 | |
Retrieved 1 of 1 entries in 24 ms
(Link to these results)