Host taxon 9606
Protein NP_001300621.1
uncharacterized protein LOC102723553
Homo sapiens
Gene SMIM11A, UniProt P58511
>NP_001300621.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|uncharacterized protein LOC102723553
MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● -4.6 | -4.60192814792082 | 0.015 | 25649146 | |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)