Host taxon 10090
Protein NP_079645.1
28S ribosomal protein S36, mitochondrial isoform 1
Mus musculus
Gene Mrps36, UniProt Q9CQX8
>NP_079645.1|Pseudomona aeruginosa PA01|28S ribosomal protein S36, mitochondrial isoform 1
MGSKMASATRVVQVVKPHAPLIKFPNRRDKPKLSASEALGSAALPSHSSAISQHSKGSTSPDLLMHQGPPDTAEIIKSLPQKYRRKPMSQEEMEFIQRGGPE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.59 | -3.5879755697323 | 2.2e-6 | 32071273 | |
Retrieved 1 of 2 entries in 69 ms
(Link to these results)