Bacterial taxon 208964
Protein WP_003092209.1
50S ribosomal protein L36
Pseudomona aeruginosa PA01
Gene rpmJ2, UniProt Q9HY26
>WP_003092209.1|Pseudomona aeruginosa PA01|50S ribosomal protein L36
MKVLASLKQAKLRHRDCQVVKRRGRLYVICKSNPRFKCVQGRPKPKIKRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ 3.24 | 3.24388364921525 | 4.2e-41 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 8.4 ms
(Link to these results)