Host taxon 10090
Protein NP_001075426.1
activated macrophage/microglia WAP domain protein precursor
Mus musculus
Gene Wfdc17, UniProt Q5SSJ1
>NP_001075426.1|Pseudomona aeruginosa PA01|activated macrophage/microglia WAP domain protein precursor
MKTATVLFLVALITVGMNTTYVVSCPKEFEKPGACPKPSPESVGICVDQCSGDGSCPGNMKCCSNSCGHVCKTPVF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.4 | 3.40209443211916 | 3.3e-34 | 32071273 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)