Bacterial taxon 208964
Protein WP_003106681.1
acyl carrier protein
Pseudomona aeruginosa PA01
Gene acpP2, UniProt O52658
>WP_003106681.1|Pseudomona aeruginosa PA01|acyl carrier protein
MDDIETRVRKLVAARFGVEECDIRLDSDFRNDFGAESLEVVELVMALEAEFGVEIADDDAERIETVRQAIDYLEEAVPT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -5.22 | -5.22090100455085 | 2.0e-68 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)