Host taxon 10090
Protein NP_001268783.1
acyloxyacyl hydrolase isoform 2 preproprotein
Mus musculus
Gene Aoah, UniProt O35298
>NP_001268783.1|Pseudomona aeruginosa PA01|acyloxyacyl hydrolase isoform 2 preproprotein
MKFPWKVFKTTLLLLLLSHSLASVPSEDQPGDSYSHGQSCLGCVVLVSVIEQLAEVHNSSVQVAMERLCSYLPEKLFLKTACYFLVQTFGSDIIKLLDEAMKADVVCYALEFCKRGAVQPQCHLYPLPQDNQLISRCPERFRDQY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.07 | 4.0710600261442 | 1.1e-12 | 32071273 | |
Retrieved 1 of 2 entries in 38.1 ms
(Link to these results)