Host taxon 10090
Protein NP_031474.2
angiogenin, ribonuclease A family, member 5 precursor
Mus musculus
Gene Ang5, UniProt Q5GAN1
>NP_031474.2|Pseudomona aeruginosa PA01|angiogenin, ribonuclease A family, member 5 precursor
MVISPGSLLLVFLLSLDVIPPTLAQDNYRYKNFLNQHYDAKPTGRDYRYCESMMKKRKLTSPCKEVNTFIHDTKNNIKAICGENGRPYGVNLRISNSRFQITTCKHKGGSPKPPCQYKAFKDFRYIVIACEDGWPVHFDESFISM
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.2 | -3.20159736091117 | 2.4e-5 | 32071273 | |
Retrieved 1 of 1 entries in 23.3 ms
(Link to these results)