Host taxon 10090
Protein NP_997414.2
anterior gradient protein 3 precursor
Mus musculus
Gene Agr3, UniProt Q8R3W7
>NP_997414.2|Pseudomona aeruginosa PA01|anterior gradient protein 3 precursor
MLHSALALCLLLITVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.67 | -4.66589115251773 | 0.014 | 32071273 | |
Retrieved 1 of 1 entries in 18.2 ms
(Link to these results)