Host taxon 10090
Protein NP_035544.1
antileukoproteinase precursor
Mus musculus
Gene Slpi, UniProt P97430
>NP_035544.1|Pseudomona aeruginosa PA01|antileukoproteinase precursor
MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.29 | 3.29491729385565 | 3.1e-47 | 32071273 | |
Retrieved 1 of 2 entries in 40.9 ms
(Link to these results)