Host taxon 10090
Protein NP_001271120.1
artemin isoform 1 preproprotein
Mus musculus
Gene Artn, UniProt Q9Z0L2
>NP_001271120.1|Pseudomona aeruginosa PA01|artemin isoform 1 preproprotein
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSQHDLSLASLLGAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.43 | 3.43426015133974 | 8.2e-15 | 32071273 | |
Retrieved 1 of 1 entries in 33.7 ms
(Link to these results)