Host taxon 10090
Protein NP_031560.2
B-cell leukemia/lymphoma 2 related protein A1b
Mus musculus
Gene Bcl2a1b, UniProt Q497M6
>NP_031560.2|Pseudomona aeruginosa PA01|B-cell leukemia/lymphoma 2 related protein A1b
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQFWEMLFLLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.07 | 3.06535565734976 | 2.1e-69 | 32071273 | |
Retrieved 1 of 1 entries in 38 ms
(Link to these results)