Host taxon 10090
Protein NP_058047.1
basic leucine zipper transcriptional factor ATF-like
Mus musculus
Gene Batf, UniProt O35284
>NP_058047.1|Pseudomona aeruginosa PA01|basic leucine zipper transcriptional factor ATF-like
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.12 | 3.11811965514565 | 3.4e-33 | 32071273 | |
Retrieved 1 of 1 entries in 18.6 ms
(Link to these results)