Host taxon 10090
Protein NP_083243.1
basic leucine zipper transcriptional factor ATF-like 2 isoform 1
Mus musculus
Gene Batf2, UniProt Q8R1H8
>NP_083243.1|Pseudomona aeruginosa PA01|basic leucine zipper transcriptional factor ATF-like 2 isoform 1
MQLCGSSELLTETDLGESQKQLKKKQKNRVAAQRSRQKHTSKADALHQQHESLEKQNHALRKEIQALQTELAGWGRTLHLHERLCRVDCDPCPVLLPSGCPIQAKQPSGQPAPLGYNGCQEQLGLFQTPGSSPRAQHLSPGPCSHESPGLLPSLLPSLAFDPLMVRTPLAQLSPSPVLSASSPSGSSLLGSFSKLDPLIPSPQDQLAPPQPLRQEQPTSGRLASSDSPAALGPECSQNREHLPALPGSSTHWQKSSVAPSPQALMAFPLLSSAKVHF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.25 | 3.2457337443493 | 4.9e-42 | 32071273 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)