Host taxon 10090
Protein NP_079815.2
bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
Mus musculus
Gene Nudt2, UniProt P56380
>NP_079815.2|Pseudomona aeruginosa PA01|bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
MALRACGLIIFRRHLIPKMDNSTIEFLLLQASDGIHHWTPPKGHVDPGENDLETALRETREETGIEASQLTIIEGFRRELNYVARQKPKTVIYWLAEVKDYNVEIRLSQEHQAYRWLGLEEACQLAQFKEMKATLQEGHQFLCSTPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.65 | -3.65395758788091 | 3.2e-9 | 32071273 | |
Retrieved 1 of 2 entries in 44.6 ms
(Link to these results)