Host taxon 10090
Protein NP_036018.1
C-C motif chemokine 19 precursor
Mus musculus
Gene Ccl19, UniProt O70460
>NP_036018.1|Pseudomona aeruginosa PA01|C-C motif chemokine 19 precursor
MAPRVTPLLAFSLLVLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 7.16 | 7.16347818788831 | 5.7e-7 | 32071273 | |
Retrieved 1 of 1 entries in 200.3 ms
(Link to these results)