Host taxon 10090
Protein NP_033163.1
C-C motif chemokine 22 precursor
Mus musculus
Gene Ccl22, UniProt O88430
>NP_033163.1|Pseudomona aeruginosa PA01|C-C motif chemokine 22 precursor
MATLRVPLLVALVLLAVAIQTSDAGPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.42 | 3.4222963466336 | 3.8e-49 | 32071273 | |
Retrieved 1 of 2 entries in 7.5 ms
(Link to these results)