Host taxon 10090
Protein NP_038682.1
C-C motif chemokine 7 precursor
Mus musculus
Gene Ccl7, UniProt Q03366
>NP_038682.1|Pseudomona aeruginosa PA01|C-C motif chemokine 7 precursor
MRISATLLCLLLIAAAFSIQVWAQPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 10.04 | 10.0358794727055 | 3.9e-16 | 32071273 | |
Retrieved 1 of 2 entries in 3.1 ms
(Link to these results)