Host taxon 10090
Protein NP_064332.1
C-type lectin domain family 4 member E
Mus musculus
Gene Clec4e, UniProt Q9R0Q8
>NP_064332.1|Pseudomona aeruginosa PA01|C-type lectin domain family 4 member E
MNSTKSPASHHTERGCFKNSQVLSWTIAGASILFLSGCFITRCVVTYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.61 | 5.60849178289498 | 9.8e-193 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)