Host taxon 10090
Protein NP_081494.1
C-type lectin domain family 4, member b1 isoform 2
Mus musculus
Gene Clec4b1, UniProt Q9D8Q7
>NP_081494.1|Pseudomona aeruginosa PA01|C-type lectin domain family 4, member b1 isoform 2
MVQERQLQGKAVSWSLRLWSAAVISILLLSTCFIASCVDKVWSCCPKDWKLFGSHCYLVPTVFSSASWNKSEENCSRMGAHLVVIHSQEEQDFITGILDIHAAYFIGLWDTGHRQWQWVDQTPYEESVTFWHNGEPSSDNEKCVTVYYRRNIGWGWNDISCNLKQKSVCQMKKINL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.17 | -4.1661554065013 | 0.039 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)