Host taxon 10090
Protein NP_001033693.1
C-type lectin domain family 5 member A isoform 1
Mus musculus
Gene Clec5a, UniProt Q9R007
>NP_001033693.1|Pseudomona aeruginosa PA01|C-type lectin domain family 5 member A isoform 1
MNWHMIISGLIVVVIKVVGMTFFLLYFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.26 | 4.26118169180712 | 1.0e-76 | 32071273 | |
Retrieved 1 of 1 entries in 3.5 ms
(Link to these results)