Host taxon 10090
Protein NP_067249.1
C-X-C motif chemokine 10 precursor
Mus musculus
Gene Cxcl10, UniProt P17515
>NP_067249.1|Pseudomona aeruginosa PA01|C-X-C motif chemokine 10 precursor
MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 10.08 | 10.0836257166549 | 1.4e-226 | 32071273 | |
Retrieved 1 of 2 entries in 53 ms
(Link to these results)