Host taxon 10090
Protein NP_062367.1
C-X-C motif chemokine 11 precursor
Mus musculus
Gene Cxcl11, UniProt Q9JHH5
>NP_062367.1|Pseudomona aeruginosa PA01|C-X-C motif chemokine 11 precursor
MNRKVTAIALAAIIWATAAQGFLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 7.94 | 7.94471821878997 | 5.1e-13 | 32071273 | |
Retrieved 1 of 1 entries in 17.4 ms
(Link to these results)