Host taxon 10090
Protein NP_976065.1
C-X-C motif chemokine 3 precursor
Mus musculus
Gene Cxcl3, UniProt Q6W5C0
>NP_976065.1|Pseudomona aeruginosa PA01|C-X-C motif chemokine 3 precursor
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 9.45 | 9.44530177818062 | 5.8e-9 | 32071273 | |
Retrieved 1 of 1 entries in 68.3 ms
(Link to these results)