Host taxon 10090
Protein NP_081692.1
calmodulin-like protein 3
Mus musculus
Gene Calml3, UniProt Q9D6P8
>NP_081692.1|Pseudomona aeruginosa PA01|calmodulin-like protein 3
MADQLTEEQIAEFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPTEAELQGMVNEIDKDGNGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGEKLSDEEVDEMIQAADTDGDGQVNYEEFVHMLVSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -6.31 | -6.30887316510896 | 1.4e-5 | 32071273 | |
Retrieved 1 of 1 entries in 60.4 ms
(Link to these results)