Host taxon 10090
Protein NP_081388.1
calpain small subunit 2
Mus musculus
Gene Capns2, UniProt Q9D7J7
>NP_081388.1|Pseudomona aeruginosa PA01|calpain small subunit 2
MFLAKAILEGADRGLGGALGGLLGGGGQARAGGGNIGGILGGIVNFISEAAAAQYTPEPPPQQQHFTVVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKELKTEGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVFKQYDSDHSGSLGSSQLHGAMQAAGFQLNEQLYLMIVRRYADEDGGMDFNNFISCLVRLDAMFRAFKALDRDRDGLIQVSIREWLQLTMYS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.34 | 3.33948687861112 | 3.8e-7 | 32071273 | |
Retrieved 1 of 1 entries in 38.7 ms
(Link to these results)