Bacterial taxon 208964
Protein WP_003087314.1
CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone
Pseudomona aeruginosa PA01
Gene ccoQ2, UniProt E1JGJ7
>WP_003087314.1|Pseudomona aeruginosa PA01|CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone
MDIGTLRGLGTLLIMVAFIGLVIWAYSGKRKKSFDEATMLPFADDPEAKKHVEQASRSNKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ 3.81 | 3.80610808687602 | 1.3e-169 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 43.7 ms
(Link to these results)