Host taxon 10090
Protein NP_031785.1
cellular retinoic acid-binding protein 2
Mus musculus
Gene Crabp2, UniProt P22935
>NP_031785.1|Pseudomona aeruginosa PA01|cellular retinoic acid-binding protein 2
MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.36 | 5.35556069386232 | 0.0065 | 32071273 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)