Bacterial taxon 208964
Protein WP_003094064.1
co-chaperone GroES
Pseudomona aeruginosa PA01
Gene groS, UniProt P30720
>WP_003094064.1|Pseudomona aeruginosa PA01|co-chaperone GroES
MKLRPLHDRVVIRRSEEETKTAGGIVLPGSAAEKPNRGEVVAVGTGRVLDNGEVRALAVKVGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVLED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ 3.54 | 3.54023185356879 | 3.4e-260 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 78.8 ms
(Link to these results)