Host taxon 10090
Protein NP_031782.3
complexin-1
Mus musculus
Gene Cplx1, UniProt P63040
>NP_031782.3|Pseudomona aeruginosa PA01|complexin-1
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEPEEEDESILDTVIKYLPGPLQDMFKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.5 | 4.49531864492527 | 2.0e-7 | 32071273 | |
Retrieved 1 of 1 entries in 29.7 ms
(Link to these results)