Host taxon 10090
Protein NP_001294953.1
cutA divalent cation tolerance homolog-like isoform 2
Mus musculus
Gene Cutal, UniProt Q9D1U5
>NP_001294953.1|Pseudomona aeruginosa PA01|cutA divalent cation tolerance homolog-like isoform 2
MDRPESRCPPPGSLRLVLTCLLILTAVLMYPVLRTFSLWLHSSLTGIYVSGSYSIVFVNCPNEQIARDIARAILDKKMASSVNILPKTSSLYFWKGEIEEGIEVSLVGASF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.2 | -3.19791484751268 | 1.7e-7 | 32071273 | |
Retrieved 1 of 2 entries in 5.4 ms
(Link to these results)