Host taxon 10090
Protein NP_031524.2
cyclic AMP-dependent transcription factor ATF-3
Mus musculus
Gene Atf3, UniProt Q60765
>NP_031524.2|Pseudomona aeruginosa PA01|cyclic AMP-dependent transcription factor ATF-3
MMLQHPGQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVNNRPLEMSVTKSEAAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.49 | 3.48654550726367 | 9.7e-276 | 32071273 | |
Retrieved 1 of 2 entries in 14.4 ms
(Link to these results)