Host taxon 10090
Protein NP_001158097.1
cysteine-rich DPF motif domain-containing protein 1
Mus musculus
Gene Cdpf1, UniProt Q8R3A2
>NP_001158097.1|Pseudomona aeruginosa PA01|cysteine-rich DPF motif domain-containing protein 1
MASETEPRPLGTFECQLCALSAPYSYVGQKPPDTQAVVLLEESYIMKDPFSSDKARFLVLGSRCSVCSRLVCVGPDCSLFYSKRVCLPCVQENMSAFPQEIQQDVEKRKSTSKKHSNRP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.28 | -3.27513466965673 | 2.1e-7 | 32071273 | |
Retrieved 1 of 2 entries in 48.6 ms
(Link to these results)