Host taxon 10090
Protein NP_898981.2
cytochrome P450, family 2, subfamily ab, polypeptide 1
Mus musculus
Gene Cyp2ab1, UniProt E9PZ31
>NP_898981.2|Pseudomona aeruginosa PA01|cytochrome P450, family 2, subfamily ab, polypeptide 1
MFPWALRHLSGPHQKIFQYHEAVRGFIRHEIIRHKLRTAEAPKDFINCYLSQITKAIDDPVSTFSEENLIQVVIDLFLGGTDTTATTLHWALIYLVHHRAIQERVQQELDEMLGAAQTICYEDRERLPYTRAVLHEVQRLSSVVAVGAVRQCVTSTWMHGYYVPKGTIILPNLASVLYDPECWESPHQFNPGHFLDKDGNFVANEAFLPFSAGHRVCPGEQLARMELFLMFATLLRTFQFQLPEGSQDLGLEYVFGGTLQPQPQKICAVLRQSSLSPREP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.91 | -4.91079529288545 | 0.0043 | 32071273 | |
Retrieved 1 of 3 entries in 27.4 ms
(Link to these results)