Bacterial taxon 208964
Protein WP_003113667.1
DUF1282 family protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9I1T7
>WP_003113667.1|Pseudomona aeruginosa PA01|DUF1282 family protein
MTREMARLLISPSNAWPRLRQDYDHHPFAFLVPLLLLPLLPAACLFIGTTQVGWSLPGNDSVQHLSSGSALLLATMCYLGFVAGVVIMGLFVRWVLFRTPSRPSVPGSLTFTTAIAVPLMLAGIVALVPWRILLLLAAAAACAYSVRLLFTGLPLFMRMQERQTLFYAFCILGVGFLTLLTTAFIFIELWGQSLAGSGEYLR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -5.22 | -5.21564713496205 | 1.6e-14 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 55 ms
(Link to these results)