Bacterial taxon 208964
Protein WP_003096961.1
DUF1328 domain-containing protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9HT88
>WP_003096961.1|Pseudomona aeruginosa PA01|DUF1328 domain-containing protein
MLSWAITFLIIAIIAAVLGFGGIAGAATGIAKILFVLFLVLFVVSFFFGRRRG
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -5.25 | -5.24749343074382 | 3.3e-7 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 30.5 ms
(Link to these results)